r 2019b Search Results


90
OriginLab corp origin 2019b
Origin 2019b, supplied by OriginLab corp, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/origin 2019b/product/OriginLab corp
Average 90 stars, based on 1 article reviews
origin 2019b - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Merck KGaA magnetic bead kits (human neurodegenerative disease panel 3, hndg3mag-36 k)
Magnetic Bead Kits (Human Neurodegenerative Disease Panel 3, Hndg3mag 36 K), supplied by Merck KGaA, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/magnetic bead kits (human neurodegenerative disease panel 3, hndg3mag-36 k)/product/Merck KGaA
Average 90 stars, based on 1 article reviews
magnetic bead kits (human neurodegenerative disease panel 3, hndg3mag-36 k) - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

N/A
LCK antibody was raised in Mouse using a purified recombinant fragment of human Lck expressed in E. coli as the immunogen. Mouse monoclonal LCK antibody.
  Buy from Supplier

N/A
The ADAM19 Antibody RM0148 11J23 Biotin from Novus Biologicals is a rat monoclonal antibody to ADAM19 This antibody reacts with mouse The ADAM19 Antibody RM0148 11J23 Biotin has been validated for the following applications Western
  Buy from Supplier

N/A
TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA. Rabbit polyclonal TRIM54 antibody raised against the N terminal of TRIM54.
  Buy from Supplier

N/A
Recombinant human FKBP1B protein (His tag)
  Buy from Supplier

N/A
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM71A antibody, catalog no. 70R-4190
  Buy from Supplier

N/A
The IgG Heavy Chain Antibody (RM116) [Biotin] from Novus is a IgG Heavy Chain antibody to IgG Heavy Chain. This antibody reacts with Human. The IgG Heavy Chain antibody has been validated for the following
  Buy from Supplier

N/A
Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1 (ER-alpha), and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. May play a role in ovarian
  Buy from Supplier

N/A
Rabbit polyclonal alpha Synuclein antibody
  Buy from Supplier

N/A
Rabbit polyclonal IFN beta antibody (HRP)
  Buy from Supplier

Image Search Results